PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0011s0550.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 266aa    MW: 30121.3 Da    PI: 4.5237
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0011s0550.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1017.2e-32119175258
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                          +Dgy+WrKYGqK +k+s++prsYYrCt ++C++kk+ve+s++dp+++++tYeg H h
  Kaladp0011s0550.1.p 119 EDGYKWRKYGQKFIKNSPNPRSYYRCTNPRCSAKKQVEKSSDDPETFIVTYEGLHLH 175
                          8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.2E-30109175IPR003657WRKY domain
PROSITE profilePS5081127.129113175IPR003657WRKY domain
SuperFamilySSF1182908.89E-27116175IPR003657WRKY domain
SMARTSM007743.6E-36118177IPR003657WRKY domain
PfamPF031063.9E-26119175IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDNESFEYWS AAEGDEILQE LLDDISPFFL IPSNGDSDDI DYGRWSLNEL LLSDVPYSGP  60
TVKDIEQALL EAGKRQRNEE EAKANHRASS MLENNDDSFR IENKYTLKMK SCGNGVMAED  120
GYKWRKYGQK FIKNSPNPRS YYRCTNPRCS AKKQVEKSSD DPETFIVTYE GLHLHFTYPY  180
LLQNQAPAAS ASAQSLYDPP TKKQKTTQAD GSNNEAAQLH TYQEQLLLEE CSFFDEAHIG  240
MESQGLLQDV VPLMIRNSTS YGFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-201171791375WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006480891.12e-68PREDICTED: probable WRKY transcription factor 49
TrEMBLV4US322e-68V4US32_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.13e-38WRKY DNA-binding protein 49